PDB entry 1zq3

View 1zq3 on RCSB PDB site
Description: NMR Solution Structure of the Bicoid Homeodomain Bound to the Consensus DNA Binding Site TAATCC
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, helix-turn-helix, homeodomain, DNA-binding domain, k50, recognition helix, transcription factor, translational control
Deposited on 2005-05-18, released 2006-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 5'-d(*gp*cp*tp*cp*tp*ap*ap*tp*cp*cp*cp*cp*g)-3'
  
• Chain 'B':
  Compound: 5'-d(*cp*gp*gp*gp*gp*ap*tp*tp*ap*gp*ap*gp*c)-3'
  
• Chain 'P':
  Compound: Homeotic bicoid protein
  Species: Drosophila melanogaster
  Gene: bcd
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UAM0 (1-67)
    • cloning artifact (0)
  Domains in SCOP 1.73: d1zq3p1

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'P':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zq3P (P:)
  gprrtrttftssqiaeleqhflqgryltaprladlsaklalgtaqvkiwfknrrrrhkiq
  sdqhkdqs