PDB entry 1zpw

View 1zpw on RCSB PDB site
Description: Crystal structure of a hypothetical protein TT1823 from Thermus thermophilus
Class: structural genomics, unknown function
Keywords: hyphotetical protein, Thermus thermophilus, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-18, released 2005-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.186
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: hypothetical protein TT1823
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q746F4
  Domains in SCOPe 2.08: d1zpwx1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence, based on SEQRES records: (download)
  

  >1zpwX (X:)
  mgkrlyavaydipddtrrvklanllksygervqlsvfecylderlledlrrrarrlldlg
  qdalriypvagqvevlgvgplpelrevqvl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1zpwX (X:)
  gkrlyavaydipddtrrvklanllksygervqlsvfecylderlledlrrrarrlldlgq
  dalriypvagqvevlgvgplpe