PDB entry 1zpv

View 1zpv on RCSB PDB site
Description: ACT domain protein from Streptococcus pneumoniae
Class: structural genomics, unknown function
Keywords: ACT domain, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-05-17, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ACT domain protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP0238
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67382 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (46-47)
    Domains in SCOPe 2.07: d1zpva1, d1zpva2
  • Chain 'B':
    Compound: ACT domain protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP0238
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67382 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (46-47)
    Domains in SCOPe 2.07: d1zpvb2, d1zpvb3
  • Chain 'C':
    Compound: ACT domain protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP0238
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67382 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (46-47)
      • modified residue (87)
    Domains in SCOPe 2.07: d1zpvc2, d1zpvc3
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zpvA (A:)
    snamkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdft
    ylrnefeafgqtlnvkiniqsaaifeamyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zpvA (A:)
    namkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdfty
    lrnefeafgqtlnvkiniqsaaife
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zpvB (B:)
    snamkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdft
    ylrnefeafgqtlnvkiniqsaaifeamyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zpvB (B:)
    amkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdftyl
    rnefeafgqtlnvkiniqsaaife
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zpvC (C:)
    snamkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdft
    ylrnefeafgqtlnvkiniqsaaifeamyni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zpvC (C:)
    namkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdfty
    lrnefeafgqtlnvkiniqsaaifeamy