PDB entry 1zpq

View 1zpq on RCSB PDB site
Description: STRUCTURE OF BACTERIOPHAGE LAMBDA CII protein
Class: transcription activator
Keywords: HELIX-TURN-HELIX, TRANSCRIPTION ACTIVATION, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, transcription activator
Deposited on 2005-05-17, released 2005-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.257
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein CII
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: CII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zpqa_
  • Chain 'B':
    Compound: Regulatory protein CII
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: CII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zpqb_
  • Chain 'C':
    Compound: Regulatory protein CII
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: CII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zpqc_
  • Chain 'D':
    Compound: Regulatory protein CII
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: CII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zpqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zpqA (A:)
    mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlew
    gvvdddmarlarqvaailtnkkrpaaterseqiqmef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zpqA (A:)
    krnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvvdd
    dmarlarqvaailt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zpqB (B:)
    mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlew
    gvvdddmarlarqvaailtnkkrpaaterseqiqmef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zpqB (B:)
    rnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvvddd
    marlarqvaailtnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zpqC (C:)
    mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlew
    gvvdddmarlarqvaailtnkkrpaaterseqiqmef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zpqC (C:)
    rankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgv
    vdddmarlarqvaailtn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zpqD (D:)
    mvrankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlew
    gvvdddmarlarqvaailtnkkrpaaterseqiqmef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zpqD (D:)
    ankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvv
    dddmarlarqvaailtnk