PDB entry 1zpl

View 1zpl on RCSB PDB site
Description: E. coli F17a-G lectin domain complex with GlcNAc(beta1-O)Me
Class: cell adhesion
Keywords: fimbriae, lectins, bacterial adhesion, protein-sugar complex, cell adhesion
Deposited on 2005-05-17, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F17a-G
    Species: Escherichia coli [TaxId:562]
    Gene: F17G AF022140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zpla_
  • Chain 'B':
    Compound: F17a-G
    Species: Escherichia coli [TaxId:562]
    Gene: F17G AF022140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zplb_
  • Heterogens: MAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zplA (A:)
    avsfigstendvgpslgsysrthamdnlpfvydtrnkigyqnanvwhiskgfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtkysrgtamsgnswenvfsgwcvgantastqg
    lsvrvtpvilkrnssarysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zplA (A:)
    avsfigstendvgpslgsysrnlpfvytrnkigyqnanvwhiskgfcvgldgkvdlpvvg
    sldgqsiyglteevglliwmgdtkysrgtamsgnswenvfsgwcvgantastqglsvrvt
    pvilkrnarysvqktsigsirmrpyngssagsvqttvnfslnpftlnd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zplB (B:)
    avsfigstendvgpslgsysrthamdnlpfvydtrnkigyqnanvwhiskgfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtkysrgtamsgnswenvfsgwcvgantastqg
    lsvrvtpvilkrnssarysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zplB (B:)
    avsfigstendvgpslgsysrnlpfvytrnkigyqnanvwhiskgfcvgldgkvdlpvvg
    sldgqsiyglteevglliwmgdtkysrgtamsgnswenvfsgwcvgantastqglsvrvt
    pvilkrnarysvqktsigsirmrpyngssagsvqttvnfslnpftlnd