PDB entry 1zpk

View 1zpk on RCSB PDB site
Description: Crystal structure of the complex of mutant HIV-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[R-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
Class: hydrolase/hydrolase inhibitor
Keywords: hiv, protease, peptidomimetic inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2005-05-17, released 2006-04-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.159
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367
    • engineered (70)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.01: d1zpka_
• Chain 'B':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (70)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.01: d1zpkb_
• Heterogens: 0ZS, CL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zpkA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkvigtvlvgptptnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zpkB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkvigtvlvgptptnvigrnlltqigctlnf