PDB entry 1zpk

View 1zpk on RCSB PDB site
Description: Crystal structure of the complex of mutant HIV-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[R-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
Class: hydrolase/hydrolase inhibitor
Keywords: hiv, protease, peptidomimetic inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2005-05-17, released 2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.159
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367
      • engineered (70)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.08: d1zpka_
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (70)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.08: d1zpkb_
  • Heterogens: 0ZS, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zpkA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkvigtvlvgptptnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zpkB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkvigtvlvgptptnvigrnlltqigctlnf