PDB entry 1zpk
View 1zpk on RCSB PDB site
Description: Crystal structure of the complex of mutant HIV-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[R-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
Class: hydrolase/hydrolase inhibitor
Keywords: hiv, protease, peptidomimetic inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on
2005-05-17, released
2006-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.159
AEROSPACI score: 0.56
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367
- engineered (70)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d1zpka_ - Chain 'B':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (70)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d1zpkb_ - Heterogens: 0ZS, CL, NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1zpkA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1zpkB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf