PDB entry 1zp8

View 1zp8 on RCSB PDB site
Description: HIV Protease with inhibitor AB-2
Class: hydrolase
Keywords: protease, retroviral
Deposited on 2005-05-16, released 2005-06-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • variant (6)
    Domains in SCOP 1.73: d1zp8a1
  • Heterogens: AB2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zp8A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf