PDB entry 1zp6

View 1zp6 on RCSB PDB site
Description: Crystal Structure of Atu3015, a Putative Cytidylate Kinase from Agrobacterium tumefaciens, Northeast Structural Genomics Target AtR62
Class: structural genomics, unknown function
Keywords: alpha-beta protein., Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-05-16, released 2005-05-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.253
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Atu3015
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UBK1
      • modified residue (66)
      • modified residue (68)
    Domains in SCOPe 2.01: d1zp6a1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zp6A (A:)
    mnmtddlggnilllsghpgsgkstiaealanlpgvpkvhfhsddlwgyikhgridpwlpq
    shqqnrmimqiaadvagryakegyfvildgvvrpdwlpaftalarplhyivlrttaaeai
    ercldrggdslsdplvvadlhsqfadlgafehhvlpvsgkdtdqalqsainalqsgrfri
    daslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zp6A (A:)
    dlggnilllsghpgsgkstiaealanlpgvpkvhfhsddlwgyikhgridpwlpqshqqn
    rmimqiaadvagryakegyfvildgvvrpdwlpaftalarplhyivlrttaaeaiercld
    rggdslsdplvvadlhsqfadlgafehhvlpvsgkdtdqalqsainalqsgrfrid