PDB entry 1zoy

View 1zoy on RCSB PDB site
Description: Crystal Structure of Mitochondrial Respiratory Complex II from porcine heart at 2.4 Angstroms
Class: oxidoreductase
Keywords: succinate, ubiquinone oxidoreductase, mitochondrial respiratory Complex II, membrane protein structure, OXIDOREDUCTASE
Deposited on 2005-05-15, released 2005-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAD-binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zoya1, d1zoya2, d1zoya3
  • Chain 'B':
    Compound: Iron-sulfur protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zoyb1, d1zoyb2
  • Chain 'C':
    Compound: Large cytochrome binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZOY (Start-139)
    Domains in SCOPe 2.08: d1zoyc_
  • Chain 'D':
    Compound: Small cytochrome binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zoyd_
  • Heterogens: FAD, FES, SF4, F3S, UQ1, HEM, EPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zoyA (A:)
    ssakvsdaistqypvvdhefdavvvgaggaglraafglseagfntacvtklfptrshtva
    aqgginaalgnmeednwrwhfydtvkgsdwlgdqdaihymteqapasvvelenygmpfsr
    tedgkiyqrafggqslkfgkggqahrcccvadrtghsllhtlygrslrydtsyfveyfal
    dllmengecrgvialciedgsihrirarntvvatggygrtyfsctsahtstgdgtamvtr
    aglpcqdlefvqfhptgiygagclitegcrgeggilinsqgerfmeryapvakdlasrdv
    vsrsmtleiregrgcgpekdhvylqlhhlppeqlavrlpgisetamifagvdvtkepipv
    lptvhynmggiptnykgqvlrhvngqdqvvpglyacgeaacasvhganrlganslldlvv
    fgracalsiaescrpgdkvpsikpnageesvmnldklrfangtirtselrlsmqksmqsh
    aavfrvgsvlqegcekilrlygdlqhlktfdrgmvwntdlvetlelqnlmlcalqtiyga
    earkesrgaharedfkervdeydyskpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyr
    pvidktlneadcatvppairsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zoyA (A:)
    stqypvvdhefdavvvgaggaglraafglseagfntacvtklfptrshtvaaqgginaal
    gnmeednwrwhfydtvkgsdwlgdqdaihymteqapasvvelenygmpfsrtedgkiyqr
    afggqslkfgkggqahrcccvadrtghsllhtlygrslrydtsyfveyfaldllmengec
    rgvialciedgsihrirarntvvatggygrtyfsctsahtstgdgtamvtraglpcqdle
    fvqfhptgiygagclitegcrgeggilinsqgerfmeryapvakdlasrdvvsrsmtlei
    regrgcgpekdhvylqlhhlppeqlavrlpgisetamifagvdvtkepipvlptvhynmg
    giptnykgqvlrhvngqdqvvpglyacgeaacasvhganrlganslldlvvfgracalsi
    aescrpgdkvpsikpnageesvmnldklrfangtirtselrlsmqksmqshaavfrvgsv
    lqegcekilrlygdlqhlktfdrgmvwntdlvetlelqnlmlcalqtiygaearkesrga
    haredfkervdeydyskpiqgqqkkpfqehwrkhtlsyvdvktgkvsleyrpvidktlne
    adcatvppairsy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zoyB (B:)
    aqtaaataprikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstlt
    frrscregicgscamninggntlactrridtnldkvskiyplphmyvikdlvpdlsnfya
    qyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwngdkylg
    pavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgkaiaeikk
    mmatykekkasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zoyB (B:)
    prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
    icgscamninggntlactrridtnldkvskiyplphmyvikdlvpdlsnfyaqyksiepy
    lkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwngdkylgpavlmqay
    rwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgkaiaeikkmmatyke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zoyC (C:)
    lgttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsa
    lllpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqlt
    qsgvvvliltvlssvglaam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zoyC (C:)
    ttakeemerfwnknlgsnrplsphitiyrwslpmamsichrgtgialsagvslfglsall
    lpgnfeshlelvkslclgptliytakfgivfplmyhtwngirhliwdlgkgltipqltqs
    gvvvliltvlssvglaam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zoyD (D:)
    asskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvr
    gdalqkaakagllalsaftfaglcyfnyhdvgickavamlwkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zoyD (D:)
    sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg
    dalqkaakagllalsaftfaglcyfnyhdvgickavamlwkl