PDB entry 1zot

View 1zot on RCSB PDB site
Description: crystal structure analysis of the CyaA/C-Cam with PMEAPP
Class: lyase
Keywords: CyaA, adenylyl cyclase toxin, PMEapp, ATP, Calmodulin-binding, LYASE
Deposited on 2005-05-13, released 2005-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.252
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: CyaA with C-terminal Calmodulin
  Species: Bordetella pertussis [TaxId:520]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15318 (0-357)
• Chain 'B':
  Compound: calmodulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62158 (0-68)
  Domains in SCOPe 2.06: d1zotb_
• Heterogens: CA, MG, EMA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zotB (B:)
  tdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny
  eefvqmmta