PDB entry 1zot

View 1zot on RCSB PDB site
Description: crystal structure analysis of the CyaA/C-Cam with PMEAPP
Class: lyase
Keywords: CyaA, adenylyl cyclase toxin, PMEapp, ATP, Calmodulin-binding, LYASE
Deposited on 2005-05-13, released 2005-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.252
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CyaA with C-terminal Calmodulin
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zotb_
  • Heterogens: CA, MG, EMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zotB (B:)
    tdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny
    eefvqmmta