PDB entry 1zor

View 1zor on RCSB PDB site
Description: Isocitrate dehydrogenase from the hyperthermophile Thermotoga maritima
Class: oxidoreductase
Keywords: wild type enzyme, cis-proline, thermostable, OXIDOREDUCTASE
Deposited on 2005-05-13, released 2006-05-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1148
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zora_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1148
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1zorb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zorA (A:)
    mekvkvknpiveldgdemarvmwkmikeklilpyldiqlvyfdlgikkrdetddqitiea
    akaikkygvgvkcatitpdaervkeynlkkawkspnatirayldgtvfrkpimvknvppl
    vkrwkkpiiigrhaygdiynaveakvegpaevelvvrnkenktllvhkfegngvvmamhn
    leksirsfaqscinyaisekvdiwfatkdtiskvyhayfkdifqeevdkrkeelekagvn
    yrymliddaaaqilrseggmlwacmnyegdimsdmiasgfgslglmtsvlvspdgvyefe
    aahgtvrrhyyrylkgektstnptasifawtgairkrgeldgtpevcefadklekavint
    iesgvitkdlqpfteppidkyvtleefidevkknlekll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zorB (B:)
    mekvkvknpiveldgdemarvmwkmikeklilpyldiqlvyfdlgikkrdetddqitiea
    akaikkygvgvkcatitpdaervkeynlkkawkspnatirayldgtvfrkpimvknvppl
    vkrwkkpiiigrhaygdiynaveakvegpaevelvvrnkenktllvhkfegngvvmamhn
    leksirsfaqscinyaisekvdiwfatkdtiskvyhayfkdifqeevdkrkeelekagvn
    yrymliddaaaqilrseggmlwacmnyegdimsdmiasgfgslglmtsvlvspdgvyefe
    aahgtvrrhyyrylkgektstnptasifawtgairkrgeldgtpevcefadklekavint
    iesgvitkdlqpfteppidkyvtleefidevkknlekll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zorB (B:)
    vkvknpiveldgdemarvmwkmikeklilpyldiqlvyfdlgikkrdetddqitieaaka
    ikkygvgvkcatitpdaervkeynlkkawkspnatirayldgtvfrkpimvknvpplvkr
    wkkpiiigrhaygdiynaveakvegpaevelvvrnkenktllvhkfegngvvmamhnlek
    sirsfaqscinyaisekvdiwfatkdtiskvyhayfkdifqeevdkrkeelekagvnyry
    mliddaaaqilrseggmlwacmnyegdimsdmiasgfgslglmtsvlvspdgvyefeaah
    gtvrrhyyrylkgektstnptasifawtgairkrgeldgtpevcefadklekavinties
    gvitkdlqpfteppidkyvtleefidevkknlekll