PDB entry 1zol

View 1zol on RCSB PDB site
Description: native beta-PGM
Class: isomerase
Keywords: native beta-phosphoglucomutase, ISOMERASE
Deposited on 2005-05-13, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: LL0429
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zola_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zolA (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk