PDB entry 1zok

View 1zok on RCSB PDB site
Description: PDZ1 Domain Of Synapse Associated Protein 97
Class: membrane protein
Keywords: PDZ, PDZ1, SAP97, Synapse Associated Protein 97, Beta Strand, Helix, MEMBRANE PROTEIN
Deposited on 2005-05-13, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Presynaptic protein SAP97
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zoka1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zokA (A:)
    eyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrlrvndcilrvn
    eadvrdvthskavealkeagsivrlyvkrrkaf