PDB entry 1zoh

View 1zoh on RCSB PDB site
Description: Crystal structure of protein kinase CK2 in complex with TBB-derivatives inhibitors
Class: transferase
Keywords: Protein kinase CK2, tetrabromo-benzimidazole, TBB, inhibitors, pharmacophore, TRANSFERASE
Deposited on 2005-05-13, released 2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.165
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase ck2, alpha subunit
    Species: Zea mays [TaxId:4577]
    Gene: ACK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zoha_
  • Heterogens: NA, CL, K44, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zohA (A:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaensrtra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zohA (A:)
    mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraae