PDB entry 1zo9

View 1zo9 on RCSB PDB site
Description: Crystal Structure Of The Wild Type Heme Domain Of P450BM-3 with N-palmitoylmethionine
Class: oxidoreductase
Keywords: Cytochrome P-450, Wild type Heme protein, OXIDOREDUCTASE
Deposited on 2005-05-12, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: CYP102A1, cyp102
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zo9a_
  • Chain 'B':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: CYP102A1, cyp102
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zo9b_
  • Heterogens: HEM, EPM, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zo9A (A:)
    gamtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrl
    ikeacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyha
    mmvdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsm
    vraldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthm
    lngkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarv
    lvdpvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvli
    pqlhrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmm
    lkhfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zo9A (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zo9B (B:)
    gamtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrl
    ikeacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyha
    mmvdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsm
    vraldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthm
    lngkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarv
    lvdpvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvli
    pqlhrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmm
    lkhfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zo9B (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggi