PDB entry 1zo4

View 1zo4 on RCSB PDB site
Description: Crystal Structure Of A328S Mutant Of The Heme Domain Of P450BM-3
Class: oxidoreductase
Keywords: cytochrome P-450, Hemeprotein A328S, OXIDOREDUCTASE
Deposited on 2005-05-12, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.189
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: CYP102A1, cyp102
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779 (3-End)
      • engineered (330)
    Domains in SCOPe 2.07: d1zo4a_
  • Chain 'B':
    Compound: bifunctional p-450:nadph-p450 reductase
    Species: Bacillus megaterium [TaxId:1404]
    Gene: CYP102A1, cyp102
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14779 (3-End)
      • engineered (330)
    Domains in SCOPe 2.07: d1zo4b_
  • Heterogens: HEM, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zo4A (A:)
    gamtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrl
    ikeacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyha
    mmvdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsm
    vraldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthm
    lngkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarv
    lvdpvpsykqvkqlkyvgmvlnealrlwptspafslyakedtvlggeyplekgdelmvli
    pqlhrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmm
    lkhfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zo4A (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptspafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zo4B (B:)
    gamtikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrl
    ikeacdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyha
    mmvdiavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsm
    vraldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthm
    lngkdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarv
    lvdpvpsykqvkqlkyvgmvlnealrlwptspafslyakedtvlggeyplekgdelmvli
    pqlhrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmm
    lkhfdfedhtnyeldiketltlkpegfvvkakskkiplggipspsteqsakkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zo4B (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptspafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplgg