PDB entry 1zo1

View 1zo1 on RCSB PDB site
Description: IF2, IF1, and tRNA fitted to cryo-EM data OF E. COLI 70S initiation complex
Class: translation/RNA
Keywords: E. COLI, RIBOSOME, INITIATION OF PROTEIN SYNTHESIS, INITIATION FACTOR, CRYO-ELETRON MICROSCOPY, translation-RNA COMPLEX
Deposited on 2005-05-12, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: EM
Resolution: 13.8 Å
R-factor: N/A
AEROSPACI score: -0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: P/I-site tRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'I':
    Compound: translation initiation factor 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: translation Initiation Factor 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zo1w1

PDB Chain Sequences:

  • Chain 'F':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zo1W (W:)
    akekdtirtegvvtealpnatfrvkldsgpeilayisgkmrmhyirilpgdrvvveitpy
    dptrgrivyrk