PDB entry 1zo0

View 1zo0 on RCSB PDB site
Description: NMR structure of antizyme isoform 1 from rat
Class: lyase inhibitor
Keywords: Antizyme, ornithine decarboxylase inhibitor, LYASE INHIBITOR
Deposited on 2005-05-12, released 2005-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ornithine decarboxylase antizyme
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zo0a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zo0A (A:)
    ilysderlnvteeptsndktrvlsiqctlteakqvtwravwnggglyielpagplpegsk
    dsfaallefaeeqlradhvficfpknredraallrtfsflgfeivrpghplvpkrpdacf
    mvytle