PDB entry 1zo0

View 1zo0 on RCSB PDB site
Description: NMR structure of antizyme isoform 1 from rat
Class: lyase inhibitor
Keywords: Antizyme, ornithine decarboxylase inhibitor
Deposited on 2005-05-12, released 2005-07-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-19, with a file datestamp of 2007-06-04.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ornithine decarboxylase antizyme
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54370 (0-125)
  Domains in SCOP 1.73: d1zo0a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zo0A (A:)
  ilysderlnvteeptsndktrvlsiqctlteakqvtwravwnggglyielpagplpegsk
  dsfaallefaeeqlradhvficfpknredraallrtfsflgfeivrpghplvpkrpdacf
  mvytle