PDB entry 1znz

View 1znz on RCSB PDB site
Description: Crystal Structure Of The Reduced Form Of Mycobacterium tuberculosis Guanylate Kinase In Complex With GDP
Class: Transferase
Keywords: Guanylate kinase, GMP kinase, ATP:GMP-phosphotransferase, Transferase
Deposited on 2005-05-12, released 2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gmk (RV1389)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1znza_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1znzA (A:)
    svgegpdtkptargqpaavgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprp
    gevdgvdyhfidptrfqqlidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievd
    lagaraikktmpeavtvflappswqdlqarligrgtetadviqrrldtarielaaqgdfd
    kvvvnrrlesacaelvsllvgtapgsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znzA (A:)
    vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
    lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
    lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
    lvg