PDB entry 1znw

View 1znw on RCSB PDB site
Description: Crystal Structure Of Unliganded Form Of Mycobacterium tuberculosis Guanylate Kinase
Class: Transferase
Keywords: Guanylate kinase, GMP kinase, ATP:GMP-phosphotransferase, Transferase
Deposited on 2005-05-12, released 2005-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: gmk (RV1389)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1znwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1znwA (A:)
    svgegpdtkptargqpaavgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprp
    gevdgvdyhfidptrfqqlidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievd
    lagaraikktmpeavtvflappswqdlqarligrgtetadviqrrldtarielaaqgdfd
    kvvvnrrlesacaelvsllvgtapgsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znwA (A:)
    vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
    lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
    lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
    lv