PDB entry 1znv

View 1znv on RCSB PDB site
Description: How a His-metal finger endonuclease ColE7 binds and cleaves DNA with a transition metal ion cofactor
Class: Hydrolase/PROTEIN BINDING
Keywords: H-N-H motif, Ni-binding, protein-protein complex, endonuclease, Hydrolase-PROTEIN BINDING COMPLEX
Deposited on 2005-05-12, released 2006-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e7 immunity protein
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: cei7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1znva_
  • Chain 'B':
    Compound: colicin e7
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: cei7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (Start-133)
      • engineered (102)
    Domains in SCOPe 2.08: d1znvb_
  • Chain 'C':
    Compound: colicin e7 immunity protein
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: cei7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1znvc_
  • Chain 'D':
    Compound: colicin e7
    Species: Escherichia coli str. K12 substr. [TaxId:316407]
    Gene: cei7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112 (Start-133)
      • engineered (102)
    Domains in SCOPe 2.08: d1znvd_
  • Heterogens: NI, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1znvA (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znvA (A:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1znvB (B:)
    meskrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfwee
    vskdpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelheekpisqnggvydmdnis
    vvtpkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znvB (B:)
    pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
    skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheevydmdnisvvtpkrhidihrgk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1znvC (C:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znvC (C:)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1znvD (D:)
    meskrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfwee
    vskdpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelheekpisqnggvydmdnis
    vvtpkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znvD (D:)
    pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
    skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheevydmdnisvvtpkrhidihrgk