PDB entry 1zns

View 1zns on RCSB PDB site
Description: Crystal structure of N-ColE7/12-bp DNA/Zn complex
Class: Hydrolase/DNA
Keywords: H-N-H motif, endonuclease, colicin, protein-DNA complex, HIS-metal finger, Hydrolase-DNA COMPLEX
Deposited on 2005-05-12, released 2006-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e7
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: cea7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47112
      • engineered (102)
    Domains in SCOPe 2.08: d1znsa_
  • Chain 'B':
    Compound: 5'-d(*cp*gp*gp*gp*ap*tp*ap*tp*cp*cp*cp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*gp*gp*gp*ap*tp*ap*tp*cp*cp*cp*g)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1znsA (A:)
    meskrnkpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfwee
    vskdpelskqfsrnnndrmkvgkapktrtqdvsgkrtsfelheekpisqnggvydmdnis
    vvtpkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znsA (A:)
    pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
    skqfsrnnndrmkvgkapktrtqdvsgkrtsfelheekvydmdnisvvtpkrhidihr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.