PDB entry 1znq

View 1znq on RCSB PDB site
Description: Crsytal Structure of Human Liver GAPDH
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2005-05-11, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: GAPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1znqo1, d1znqo2
  • Chain 'P':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: GAPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1znqp1, d1znqp2
  • Chain 'Q':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: GAPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1znqq1, d1znqq2
  • Chain 'R':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: GAPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1znqr1, d1znqr2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1znqO (O:)
    gshmgkvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfh
    gtvkaengklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggak
    rviisapsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmtt
    vhaitatqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvpt
    anvsvvdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfda
    gagialndhfvkliswydnefgysnrvvdlmahmaske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znqO (O:)
    kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
    engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
    apsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvhait
    atqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanvsv
    vdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagagia
    lndhfvkliswydnefgysnrvvdlmahmaske
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1znqP (P:)
    gshmgkvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfh
    gtvkaengklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggak
    rviisapsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmtt
    vhaitatqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvpt
    anvsvvdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfda
    gagialndhfvkliswydnefgysnrvvdlmahmaske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znqP (P:)
    kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
    engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
    apsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvhait
    atqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanvsv
    vdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagagia
    lndhfvkliswydnefgysnrvvdlmahmaske
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1znqQ (Q:)
    gshmgkvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfh
    gtvkaengklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggak
    rviisapsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmtt
    vhaitatqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvpt
    anvsvvdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfda
    gagialndhfvkliswydnefgysnrvvdlmahmaske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znqQ (Q:)
    kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
    engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
    apsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvhait
    atqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanvsv
    vdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagagia
    lndhfvkliswydnefgysnrvvdlmahmaske
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1znqR (R:)
    gshmgkvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfh
    gtvkaengklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggak
    rviisapsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmtt
    vhaitatqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvpt
    anvsvvdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfda
    gagialndhfvkliswydnefgysnrvvdlmahmaske
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znqR (R:)
    kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
    engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
    apsadapmfvmgvnhekydnslkiisnascttnclaplakvihdnfgiveglmttvhait
    atqktvdgpsgklwrdgrgalqniipastgaakavgkvipelngkltgmafrvptanvsv
    vdltcrlekpakyddikkvvkqasegplkgilgytehqvvssdfnsdthsstfdagagia
    lndhfvkliswydnefgysnrvvdlmahmaske