PDB entry 1znp

View 1znp on RCSB PDB site
Description: X-Ray Crystal Structure of Protein Q8U9W0 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR55.
Class: structural genomics, unknown function
Keywords: NESG, ATR55, Q8U9W0, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-05-11, released 2005-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Atu3615
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR L 2421
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U9W0
      • modified residue (4)
      • modified residue (134)
    Domains in SCOPe 2.08: d1znpa1
  • Chain 'B':
    Compound: hypothetical protein Atu3615
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR L 2421
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U9W0
      • modified residue (4)
      • modified residue (134)
    Domains in SCOPe 2.08: d1znpb_
  • Chain 'C':
    Compound: hypothetical protein Atu3615
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR L 2421
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U9W0
      • modified residue (4)
      • modified residue (134)
    Domains in SCOPe 2.08: d1znpc_
  • Chain 'D':
    Compound: hypothetical protein Atu3615
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR L 2421
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U9W0
      • modified residue (4)
      • modified residue (134)
    Domains in SCOPe 2.08: d1znpd_
  • Chain 'E':
    Compound: hypothetical protein Atu3615
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR L 2421
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U9W0
      • modified residue (4)
      • modified residue (134)
    Domains in SCOPe 2.08: d1znpe_
  • Chain 'F':
    Compound: hypothetical protein Atu3615
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR L 2421
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U9W0
      • modified residue (4)
      • modified residue (134)
    Domains in SCOPe 2.08: d1znpf_
  • Chain 'G':
    Compound: hypothetical protein Atu3615
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: AGR L 2421
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U9W0
      • modified residue (4)
      • modified residue (134)
    Domains in SCOPe 2.08: d1znpg_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1znpA (A:)
    mgtdmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtd
    avevwhyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlv
    gctvspgfafssfvmaepgwspgdaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znpA (A:)
    dmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdave
    vwhyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgct
    vspgfafssfvmaepgwspg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1znpB (B:)
    mgtdmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtd
    avevwhyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlv
    gctvspgfafssfvmaepgwspgdaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znpB (B:)
    msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
    whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
    spgfafssfvmaepgwspgd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1znpC (C:)
    mgtdmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtd
    avevwhyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlv
    gctvspgfafssfvmaepgwspgdaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znpC (C:)
    msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
    whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
    spgfafssfvmaepgwsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1znpD (D:)
    mgtdmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtd
    avevwhyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlv
    gctvspgfafssfvmaepgwspgdaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znpD (D:)
    msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
    whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
    spgfafssfvmaepgwsp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1znpE (E:)
    mgtdmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtd
    avevwhyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlv
    gctvspgfafssfvmaepgwspgdaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znpE (E:)
    msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
    whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
    spgfafssfvmaepgwspg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1znpF (F:)
    mgtdmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtd
    avevwhyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlv
    gctvspgfafssfvmaepgwspgdaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znpF (F:)
    msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
    whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
    spgfafssfvmaepgwspgd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1znpG (G:)
    mgtdmsaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtd
    avevwhyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlv
    gctvspgfafssfvmaepgwspgdaplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znpG (G:)
    msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
    whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
    spgfafssfvmaepgwspgd