PDB entry 1zno

View 1zno on RCSB PDB site
Description: Crystal Structure of VC702 from Vibrio Cholerae, Northeast Structural Genomics Consortium Target: VcP1
Class: structural genomics, unknown function
Keywords: mixed alpha/beta sandwich, homodimer, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-05-11, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.23
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0244 protein VC0702
    Species: Vibrio cholerae [TaxId:666]
    Gene: vibrio cholerae
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU27
      • modified residue (9)
      • modified residue (54)
      • modified residue (96)
      • modified residue (113)
      • modified residue (132)
    Domains in SCOPe 2.07: d1znoa_
  • Chain 'B':
    Compound: Hypothetical UPF0244 protein VC0702
    Species: Vibrio cholerae [TaxId:666]
    Gene: vibrio cholerae
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU27
      • modified residue (9)
      • modified residue (54)
      • modified residue (96)
      • modified residue (113)
      • modified residue (132)
    Domains in SCOPe 2.07: d1znob_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1znoA (A:)
    mppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeet
    kqgalnrvrnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvl
    erlrqakelgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehy
    psa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znoA (A:)
    mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
    nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerllgdvmd
    evenikqkggaiglltrhhltrstvyhqalilalipfinpehyps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1znoB (B:)
    mppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeet
    kqgalnrvrnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvl
    erlrqakelgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehy
    psa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znoB (B:)
    mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
    nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakgd
    vmdeikqkggaiglltrhhltrstvyhqalilalipfinpehyps