PDB entry 1znl

View 1znl on RCSB PDB site
Description: Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex
Class: Transport Protein
Keywords: lIPOCALIN, BETA-BARREL, DECAN-1-OL, Transport Protein
Deposited on 2005-05-11, released 2005-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major urinary protein
    Species: Mus musculus [TaxId:10090]
    Gene: MUP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1znla_
  • Heterogens: CD, DE1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1znlA (A:)
    mrgshhhhhhgseeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvl
    ekslvlkfhtvrdeecselsmvadktekageysvtydgfntftipktdydnflmahline
    kdgetfqlmglygrepdlssdikerfaqlceehgilreniidlsnanrclqare
    

    Sequence, based on observed residues (ATOM records): (download)
    >1znlA (A:)
    eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
    deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
    grepdlssdikerfaqlceehgilreniidlsnanrc