PDB entry 1znj

View 1znj on RCSB PDB site
Description: insulin, monoclinic crystal form
Class: hormone
Keywords: hormone, metabolic role, chemical activity, insulin glucose metabolism, diabetes
Deposited on 1997-09-23, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1znj.1
• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1znj.1
• Chain 'C':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1znj.2
• Chain 'D':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1znj.2
• Chain 'E':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1znj.3
• Chain 'F':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1znj.3
• Chain 'G':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1znj.4
• Chain 'H':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.08: d1znj.4
• Chain 'I':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1znj.5
• Chain 'J':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1znj.5
• Chain 'K':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1znj.6
• Chain 'L':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
  Domains in SCOPe 2.08: d1znj.6
• Heterogens: IPH, ZN, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >1znjD (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1znjD (D:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjE (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >1znjF (F:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1znjF (F:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjG (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >1znjH (H:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1znjH (H:)
  fvnqhlcgshlvealylvcgergffytpk
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjI (I:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjJ (J:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjK (K:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1znjL (L:)
  fvnqhlcgshlvealylvcgergffytpkt