PDB entry 1zni

View 1zni on RCSB PDB site
Description: insulin
Deposited on 1997-09-23, released 1998-01-28
The last revision prior to the SCOP 1.61 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.178
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1zni.1
  • Chain 'B':
    Domains in SCOP 1.61: d1zni.1
  • Chain 'C':
    Domains in SCOP 1.61: d1zni.2
  • Chain 'D':
    Domains in SCOP 1.61: d1zni.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zniA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zniB (B:)
fvnqhlcgshlvealylvcgergffytpka

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zniC (C:)
giveqcctsicslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zniD (D:)
fvnqhlcgshlvealylvcgergffytpka