PDB entry 1zni

View 1zni on RCSB PDB site
Description: insulin
Class: hormone
Keywords: hormone, glucose metabolism
Deposited on 1997-09-23, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zni.1
  • Chain 'B':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zni.1
  • Chain 'C':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zni.2
  • Chain 'D':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zni.2
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zniA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zniB (B:)
    fvnqhlcgshlvealylvcgergffytpka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zniC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zniD (D:)
    fvnqhlcgshlvealylvcgergffytpka