PDB entry 1zne

View 1zne on RCSB PDB site
Description: Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex
Class: Transport Protein
Keywords: lipocalin, beta-barrel
Deposited on 2005-05-11, released 2005-12-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major urinary protein
    Species: MUS MUSCULUS
    Gene: MUP1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1znea1
  • Heterogens: CD, HE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zneA (A:)
    mrgshhhhhhgseeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvl
    ekslvlkfhtvrdeecselsmvadktekageysvtydgfntftipktdydnflmahline
    kdgetfqlmglygrepdlssdikerfaqlceehgilreniidlsnanrclqare
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zneA (A:)
    eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
    deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
    grepdlssdikerfaqlceehgilreniidlsnanrc