PDB entry 1zn2

View 1zn2 on RCSB PDB site
Description: Low Resolution Structure of Response Regulator StyR
Class: transcription regulator
Keywords: Transcription regulation, styrene degradation, transcription regulator
Deposited on 2005-05-11, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.269
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: response regulatory protein
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zn2a1, d1zn2a2
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zn2A (A:)
    mtakptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhgclvldmrmpg
    msgielqeqltaisdgipivfitahgdipmtvramkagaieflpkpfeeqalldaieqgl
    qlnaerrqaretqdqleqlfssltgreqqvlqltirglmnkqiagelgiaevtvkvhrhn
    imqklnvrslanlvhlvekyesfergvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zn2A (A:)
    akptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhgclvldmrmpgms
    gielqeqltaisdgipivfitahgdipmtvramkagaieflpkpfeeqalldaieqglql
    naerrqaretqdqleqlfssltgreqqvlqltirglmnkqiagelgiaevtvkvhrhnim
    qklnvrslanlvhlveky