PDB entry 1zn1

View 1zn1 on RCSB PDB site
Description: Coordinates of RRF fitted into Cryo-EM map of the 70S post-termination complex
Class: BIOSYNTHETIC/structural protein/RNA
Keywords: ribosome recycling factor, elongation factor G, 70S, post-termination complex, BIOSYNTHETIC/structural protein/RNA COMPLEX
Deposited on 2005-05-11, released 2005-06-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: EM
Resolution: 14.1 Å
R-factor: N/A
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosome recycling factor
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A805 (0-184)
  Domains in SCOPe 2.05: d1zn1a1
• Chain 'B':
  Compound: ribosomal 23S RNA
  Species: Escherichia coli [TaxId:562]
  
• Chain 'C':
  Compound: ribosomal 16S RNA
  Species: Escherichia coli [TaxId:562]
  
• Chain 'L':
  Compound: 30S ribosomal protein S12
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7S3 (0-96)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zn1A (A:)
  misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
  dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
  aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
  elmqf
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.