PDB entry 1zmt

View 1zmt on RCSB PDB site
Description: Structure of haloalcohol dehalogenase HheC of Agrobacterium radiobacter AD1 in complex with (R)-para-nitro styrene oxide, with a water molecule in the halide-binding site
Class: Lyase
Keywords: haloalcohol dehalogenase, halohydrin dehalogenase, epoxide catalysis, enantioselectivity, Lyase
Deposited on 2005-05-10, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloalcohol dehalogenase HheC
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zmta_
  • Chain 'B':
    Compound: Haloalcohol dehalogenase HheC
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zmtb_
  • Chain 'C':
    Compound: Haloalcohol dehalogenase HheC
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zmtc_
  • Chain 'D':
    Compound: Haloalcohol dehalogenase HheC
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zmtd_
  • Heterogens: RNO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zmtA (A:)
    mstaivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepa
    elieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmk
    krksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhs
    edspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwla
    ggfpmierwpgmpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmtA (A:)
    staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
    lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
    rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
    dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
    gfpmierwpgmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zmtB (B:)
    mstaivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepa
    elieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmk
    krksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhs
    edspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwla
    ggfpmierwpgmpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmtB (B:)
    staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
    lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
    rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
    dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
    gfpmierwpgmp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zmtC (C:)
    mstaivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepa
    elieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmk
    krksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhs
    edspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwla
    ggfpmierwpgmpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmtC (C:)
    staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
    lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
    rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
    dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
    gfpmierwpgmp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zmtD (D:)
    mstaivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepa
    elieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmk
    krksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhs
    edspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwla
    ggfpmierwpgmpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmtD (D:)
    staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
    lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
    rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
    dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
    gfpmierwpgmp