PDB entry 1zmr

View 1zmr on RCSB PDB site
Description: Crystal Structure of the E. coli Phosphoglycerate Kinase
Class: transferase
Keywords: transferase, glycolysis, kinase
Deposited on 2005-05-10, released 2006-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Escherichia coli [TaxId:562]
    Gene: PGK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zmra_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zmrA (A:)
    msvikmtdldlagkrvfiradlnvpvkdgkvtsdariraslptielalkqgakvmvtshl
    grptegeyneefsllpvvnylkdklsnpvrlvkdyldgvdvaegelvvlenvrfnkgekk
    ddetlskkyaalcdvfvmdafgtahraqasthgigkfadvacagpllaaeldalgkalke
    parpmvaivggskvstkltvldslskiadqlivgggiantfiaaqghdvgkslyeadlvd
    eakrllttcnipvpsdvrvatefsetapatlksvndvkadeqildigdasaqelaeilkn
    aktilwngpvgvfefpnfrkgteivanaiadseafsiagggdtlaaidlfgiadkisyis
    tgggaflefvegkvlpavamleerakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmrA (A:)
    svikmtdldlagkrvfiradlnvpvkdgkvtsdariraslptielalkqgakvmvtshlg
    rptegeyneefsllpvvnylkdklsnpvrlvkdyldgvdvaegelvvlenvrfnkgekkd
    detlskkyaalcdvfvmdafgtahraqasthgigkfadvacagpllaaeldalgkalkep
    arpmvaivggskvstkltvldslskiadqlivgggiantfiaaqghdvgkslyeadlvde
    akrllttcnipvpsdvrvatefsetapatlksvndvkadeqildigdasaqelaeilkna
    ktilwngpvgvfefpnfrkgteivanaiadseafsiagggdtlaaidlfgiadkisyist
    gggaflefvegkvlpavamleerakk