PDB entry 1zme

View 1zme on RCSB PDB site
Description: crystal structure of put3/dna complex
Deposited on 1997-08-06, released 1998-09-16
The last revision prior to the SCOP 1.67 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zmeC (C:)
svaclscrkrhikcpggnpcqkcvtsnaiceylepskkivvstkylqqlqkdlndkteen
nrlkalller

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zmeD (D:)
svaclscrkrhikcpggnpcqkcvtsnaiceylepskkivvstkylqqlqkdlndkteen
nrlkalller