PDB entry 1zmb

View 1zmb on RCSB PDB site
Description: Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-05-10, released 2005-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.243
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylxylan esterase related enzyme
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97LM8 (0-281)
      • modified residue (0)
      • modified residue (6)
      • modified residue (12)
      • modified residue (23)
      • modified residue (31)
      • modified residue (39-40)
      • modified residue (105)
      • modified residue (259)
      • modified residue (276)
      • cloning artifact (282-283)
    Domains in SCOPe 2.08: d1zmba1, d1zmba2
  • Chain 'B':
    Compound: Acetylxylan esterase related enzyme
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97LM8 (0-281)
      • modified residue (0)
      • modified residue (6)
      • modified residue (12)
      • modified residue (23)
      • modified residue (31)
      • modified residue (39-40)
      • modified residue (105)
      • modified residue (259)
      • modified residue (276)
      • cloning artifact (282-283)
    Domains in SCOPe 2.08: d1zmbb2, d1zmbb3
  • Chain 'C':
    Compound: Acetylxylan esterase related enzyme
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97LM8 (0-281)
      • modified residue (0)
      • modified residue (6)
      • modified residue (12)
      • modified residue (23)
      • modified residue (31)
      • modified residue (39-40)
      • modified residue (105)
      • modified residue (259)
      • modified residue (276)
      • cloning artifact (282-283)
    Domains in SCOPe 2.08: d1zmbc2, d1zmbc3
  • Chain 'D':
    Compound: Acetylxylan esterase related enzyme
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97LM8 (0-281)
      • modified residue (0)
      • modified residue (6)
      • modified residue (12)
      • modified residue (23)
      • modified residue (31)
      • modified residue (39-40)
      • modified residue (105)
      • modified residue (259)
      • modified residue (276)
      • cloning artifact (282-283)
    Domains in SCOPe 2.08: d1zmbd2, d1zmbd3
  • Chain 'E':
    Compound: Acetylxylan esterase related enzyme
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97LM8 (0-281)
      • modified residue (0)
      • modified residue (6)
      • modified residue (12)
      • modified residue (23)
      • modified residue (31)
      • modified residue (39-40)
      • modified residue (105)
      • modified residue (259)
      • modified residue (276)
      • cloning artifact (282-283)
    Domains in SCOPe 2.08: d1zmbe2, d1zmbe3
  • Chain 'F':
    Compound: Acetylxylan esterase related enzyme
    Species: Clostridium acetobutylicum [TaxId:272562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97LM8 (0-281)
      • modified residue (0)
      • modified residue (6)
      • modified residue (12)
      • modified residue (23)
      • modified residue (31)
      • modified residue (39-40)
      • modified residue (105)
      • modified residue (259)
      • modified residue (276)
      • cloning artifact (282-283)
    Domains in SCOPe 2.08: d1zmbf2, d1zmbf3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zmbA (A:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmbA (A:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zmbB (B:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmbB (B:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zmbC (C:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmbC (C:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zmbD (D:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmbD (D:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndle
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zmbE (E:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmbE (E:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zmbF (F:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zmbF (F:)
    mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
    adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
    sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
    lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
    lnlnyarthtkaekiyiksmdfalgkisydeftselmkinndle