PDB entry 1zm5

View 1zm5 on RCSB PDB site
Description: Conjugative Relaxase TRWC in complex with ORIT dna, cooper-bound structure
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, bacterial conjugation, relaxase, DNA, DNA binding protein/DNA complex
Deposited on 2005-05-10, released 2006-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TrwC
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47673 (0-292)
      • modified residue (0)
      • modified residue (4)
      • modified residue (69)
      • modified residue (168)
    Domains in SCOPe 2.02: d1zm5a_
  • Chain 'B':
    Compound: DNA (25-mer)
  • Heterogens: SO4, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zm5A (A:)
    mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
    gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
    aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
    kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
    ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

  • Chain 'B':
    No sequence available.