PDB entry 1zlx

View 1zlx on RCSB PDB site
Description: The apo structure of human glycinamide ribonucleotide transformylase
Class: transferase
Keywords: Seven stranded beta-pleated sheet, Modified doubly wound alpha/beta sheet, Mononucleotide binding domain (beta-alpha-beta-alpha-beta), Phosphate binding loop, Folate binding loop, TRANSFERASE
Deposited on 2005-05-09, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GART, PRGS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22102 (0-End)
      • modified residue (88)
      • modified residue (103)
    Domains in SCOPe 2.07: d1zlxa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zlxA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlxA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv