PDB entry 1zlw

View 1zlw on RCSB PDB site
Description: Fab 2G12 + Man8
Class: immune system
Keywords: hiv neutralizing antibody; anti-carbohydrate; domain-swapping
Deposited on 2005-05-09, released 2005-08-09
Made obsolete by 6mnf on 2018-10-31

The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-25, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2G12, heavy chain
    Species: HOMO SAPIENS
    Gene:
    Domains in SCOP 1.75: d1zlwh1, d1zlwh2
  • Chain 'K':
    Compound: FAB 2G12, light chain
    Species: HOMO SAPIENS
    Gene:
  • Chain 'L':
    Compound: FAB 2G12, light chain
    Species: HOMO SAPIENS
    Gene:
  • Chain 'M':
    Compound: FAB 2G12, heavy chain
    Species: HOMO SAPIENS
    Gene:
    Domains in SCOP 1.75: d1zlwm1, d1zlwm2
  • Heterogens: MAN

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zlwH (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1zlwM (M:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlwM (M:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfaalgclvkdyfpepvtvswnsaltsgvhtfpavlqssglyslssvvtv
    pssslgtqtyicnvnhkpsntkvdkkvep