PDB entry 1zlt

View 1zlt on RCSB PDB site
Description: Crystal Structure of Chk1 Complexed with a Hymenaldisine Analog
Class: transferase
Keywords: kinase, TRANSFERASE
Deposited on 2005-05-09, released 2006-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.227
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zlta_
  • Heterogens: SO4, HYM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zltA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zltA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnh
    envvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgi
    githrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrref
    haepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhk
    ilvenpsaritipdikkdrwynkplkkgakrp