PDB entry 1zls

View 1zls on RCSB PDB site
Description: FAB 2G12 + Man4
Class: immune system
Keywords: hiv neutralizing antibody; anti-carbohydrate; domain-swapping, IMMUNE SYSTEM
Deposited on 2005-05-09, released 2005-08-09
Made obsolete by 6msy on 2018-11-21

The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.284
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB 2G12, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZLS (0-End)
    Domains in SCOPe 2.07: d1zlsh1, d1zlsh2
  • Chain 'L':
    Compound: FAB 2G12, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZLS (0-End)
    Domains in SCOPe 2.07: d1zlsl1, d1zlsl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1zlsH (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlsH (H:)
    evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
    adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
    vspastkgpsvfplapggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1zlsL (L:)
    vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
    fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlsL (L:)
    vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
    fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfn