PDB entry 1zlr

View 1zlr on RCSB PDB site
Description: Factor XI catalytic domain complexed with 2-guanidino-1-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethyl nicotinate
Class: hydrolase
Keywords: serine protease, boron, covalent inhibitor, HYDROLASE
Deposited on 2005-05-09, released 2006-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Coagulation factor XI
  Species: Homo sapiens [TaxId:9606]
  Gene: F11
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03951 (0-236)
    • engineered (64)
    • engineered (67)
    • engineered (105)
    • engineered (112)
  Domains in SCOPe 2.07: d1zlra_
• Heterogens: SO4, 368, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zlrA (A:)
  ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
  ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
  nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
  kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa