PDB entry 1zlm

View 1zlm on RCSB PDB site
Description: Crystal structure of the SH3 domain of human osteoclast stimulating factor
Class: signaling protein
Keywords: Beta barrel, SIGNALING PROTEIN
Deposited on 2005-05-06, released 2006-05-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.16
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Osteoclast stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: OSTF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zlma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zlmA (A:)
gqvkvfralytfeprtpdelyfeegdiiyitdmsdtnwwkgtskgrtglipsnyvaeq