PDB entry 1zlk

View 1zlk on RCSB PDB site
Description: Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain-DNA Complex
Class: Transcription/DNA
Keywords: helix-turn-helix, protein-DNA complex, Transcription/DNA COMPLEX
Deposited on 2005-05-06, released 2006-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.272
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649
    Domains in SCOPe 2.06: d1zlka_
  • Chain 'B':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649
    Domains in SCOPe 2.06: d1zlkb_
  • Chain 'C':
    Compound: 5'-d(*gp*gp*cp*cp*cp*gp*cp*gp*cp*tp*tp*tp*gp*gp*gp*gp*ap*cp*tp*ap*ap*ap*gp*tp*cp*cp*cp*tp*ap*ap*cp*cp*cp*tp*gp*gp*cp*cp*ap*cp*gp*ap*t)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*gp*tp*gp*gp*cp*cp*ap*gp*gp*gp*tp*tp*ap*gp*gp*gp*ap*cp*tp*tp*tp*ap*gp*tp*cp*cp*cp*cp*ap*ap*ap*gp*cp*gp*cp*gp*gp*gp*cp*cp*ap*t)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zlkA (A:)
    mgsshhhhhhssglvprgshmqdplsgltdqertllgllsegltnkqiadrmflaektvk
    nyvsrllaklgmerrtqaavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlkA (A:)
    dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
    telkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zlkB (B:)
    mgsshhhhhhssglvprgshmqdplsgltdqertllgllsegltnkqiadrmflaektvk
    nyvsrllaklgmerrtqaavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlkB (B:)
    dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
    telkr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.