PDB entry 1zlj

View 1zlj on RCSB PDB site
Description: Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain
Class: transcription
Keywords: helix-turn-helix, TRANSCRIPTION
Deposited on 2005-05-06, released 2006-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649
      • modified residue (34)
      • modified residue (54)
    Domains in SCOPe 2.06: d1zlja_
  • Chain 'B':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649 (4-End)
      • cloning artifact (1-3)
      • modified residue (34)
      • modified residue (54)
    Domains in SCOPe 2.06: d1zljb1, d1zljb2
  • Chain 'C':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649
      • modified residue (34)
      • modified residue (54)
    Domains in SCOPe 2.06: d1zljc_
  • Chain 'D':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649 (4-End)
      • modified residue (34)
      • modified residue (54)
    Domains in SCOPe 2.06: d1zljd_
  • Chain 'E':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649
      • modified residue (34)
      • modified residue (54)
    Domains in SCOPe 2.06: d1zlje_
  • Chain 'F':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649 (4-End)
      • cloning artifact (1-3)
      • modified residue (34)
      • modified residue (54)
    Domains in SCOPe 2.06: d1zljf1, d1zljf2
  • Chain 'G':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649
      • modified residue (34)
      • modified residue (54)
    Domains in SCOPe 2.06: d1zljg_
  • Chain 'H':
    Compound: Dormancy Survival Regulator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: dosR, devR, Rv3133c
    Database cross-references and differences (RAF-indexed):
    • GB NP_217649 (4-End)
      • modified residue (34)
      • modified residue (54)
    Domains in SCOPe 2.06: d1zljh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zljA (A:)
    gshmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtq
    aavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zljA (A:)
    dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
    telkrsrpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zljB (B:)
    gshmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtq
    aavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zljB (B:)
    shmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqa
    avfatelkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zljC (C:)
    gshmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtq
    aavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zljC (C:)
    dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
    telkrsrpp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zljD (D:)
    gshmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtq
    aavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zljD (D:)
    qdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavf
    atelkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zljE (E:)
    gshmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtq
    aavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zljE (E:)
    dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
    telkrsrpp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zljF (F:)
    gshmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtq
    aavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zljF (F:)
    shmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqa
    avfatelkr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1zljG (G:)
    gshmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtq
    aavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zljG (G:)
    dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
    telkrsrpp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1zljH (H:)
    gshmqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtq
    aavfatelkrsrppgdgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zljH (H:)
    qdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavf
    atelkr