PDB entry 1zlh

View 1zlh on RCSB PDB site
Description: Crystal structure of the tick carboxypeptidase inhibitor in complex with bovine carboxypeptidase A
Class: hydrolase/hydrolase inhibitor
Keywords: inhibitor-metallocarboxypeptidase complex, beta-defensin fold (TCI), eight-stranded twisted beta-sheet surrounded by eight alpha-helices (CPA), HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-05-06, released 2005-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.156
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.06: d1zlha_
  • Chain 'B':
    Compound: carboxypeptidase inhibitor
    Species: Rhipicephalus bursa [TaxId:67831]
    Database cross-references and differences (RAF-indexed):
    • GB AAW72225 (0-End)
    Domains in SCOPe 2.06: d1zlhb1, d1zlhb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zlhA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlhA (A:)
    stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
    widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
    nrlwrktrsvtslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdfvk
    dhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygsii
    ttiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltimeht
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zlhB (B:)
    necvskgfgclpqsdcpqearlsyggcstvccdlskltgckgkggecnpldrqckelqae
    sascgkgqkccvwlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zlhB (B:)
    necvskgfgclpqsdcpqearlsyggcstvccdlskltgckgkggecnpldrqckelqae
    sascgkgqkccvwl