PDB entry 1zlb

View 1zlb on RCSB PDB site
Description: Crystal structure of catalytically-active phospholipase A2 in the absence of calcium
Class: hydrolase
Keywords: Asp49-PLA2, toxin, snake venom
Deposited on 2005-05-05, released 2006-04-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.151
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypotensive phospholipase A2
    Species: Bothrops jararacussu
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AXY1 (0-121)
      • conflict (57)
      • conflict (78)
    Domains in SCOP 1.73: d1zlba1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zlbA (A:)
    slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
    idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
    pc